PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g43346.1.p
Common NameBRADI_4g43346
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 336aa    MW: 36433.9 Da    PI: 4.1287
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g43346.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM39.91.3e-12121336128
               NAM   6 rFhPtdeelvveyLkkkvegkkleleev.ikevdiy.kvePwdLpk....kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       rF+ +  e v++yL + ++g++l+ +e  i+++diy ++eP+dL +    + kae++ + +f +  ++  ++g+r+  a+        g++ e
  Bradi4g43346.1.p  12 RFDLSPLEAVTYYLPRLLSGETLHGAERlIHRADIYgNLEPKDLAAafppAPKAERTgDRFFLTLCKR--QKGSRSAHAAG------AGTTLE 96 
                       77778899**************7776655******9456*****844666444455524455555554..46888888765......788999 PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       v+++ g ++g  k L f kg +++ e+  Wvm+ey+ 
  Bradi4g43346.1.p  97 VVDHAGVKKGEVKKLSFKKGIKKEKESMGWVMEEYHC 133
                       99999***************99999**********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100513.2417153IPR003441NAC domain
PfamPF023652.2E-512132IPR003441NAC domain
SuperFamilySSF1019417.32E-1312152IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MELDMEVFQL SRFDLSPLEA VTYYLPRLLS GETLHGAERL IHRADIYGNL EPKDLAAAFP  60
PAPKAERTGD RFFLTLCKRQ KGSRSAHAAG AGTTLEVVDH AGVKKGEVKK LSFKKGIKKE  120
KESMGWVMEE YHCLLPEAVV ADGEMVLCKI HLSPTACDEA RQESAAYLAG TQEQEDQPAP  180
MAVTAKRPAP AASDDPPCAP KRARVAVAEA DHSQDMDGFR SPLEDLLADE PADELLGGAT  240
DEDQEEEAAA LPAGETEQQI VDFDFDLPVL DEDALSEVIL SLDEDLPIAS DEDFDFKFPT  300
AEELNAMLSN VGDWPLSFAP DGDLLRFPGL PAAVL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239526.10.0PREDICTED: uncharacterized protein LOC104585198
TrEMBLA0A0Q3HFY00.0A0A0Q3HFY0_BRADI; Uncharacterized protein
STRINGBRADI4G43010.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18322799
Representative plantOGRP9262314
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32870.21e-05NAC domain protein 13